PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr022696.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 628aa    MW: 70984.6 Da    PI: 5.7102
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr022696.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS273.47.1e-842626252374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                   + Ll++Ae v  +++e+a++lL r +  as + +p+qR+++yf+eAL++r+ + +++++yk  + s+ s  n  ++   + +f++ +P++ + +   
  Pbr022696.1 262 AHILLAAAEKVGYQQFERANRLLLRCEFAASFKVNPVQRVVFYFAEALRKRIEKeTGNGMYKGNEISTYS--NGLSTNLTFLAFYQDTPFHSVMQHPG 357
                  699***************************************************89999**999999987..34444445568*************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                   q Ile v+ e+ vH iD++i  G+QW  L++ La R+      l iT+vg    + k+++eetg+rLa++A++l++pf+f+++++ ++ed++ + ++
  Pbr022696.1 358 IQVILENVALESNVHLIDLEIRSGVQWTGLMEVLAGREeCHIELLTITAVGV---TGKQKIEETGRRLASVAKALNLPFQFKAVIVADMEDVKDQLFD 452
                  *************************************94445699*******...68***************************************** PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  v+  Ea++V   l l ++ +++ +le+    +++++++lsP v+vv+e ea+hns+sF++rf++al yysalfd+lea + +++++r+ +E   l++ 
  Pbr022696.1 453 VEDYEAVVVYAPLILRTMISRPSCLEN----LMRVMRNLSPCVMVVIEVEANHNSPSFVNRFIDALFYYSALFDCLEACM-KQEKDRVLMEGL-LHEG 544
                  *******************88888888....***********************************************96.666777777765.**** PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  i+n+v  eg+er+ r  t+e Wr+ + ++ + +++ls+ a  qa+l+ +k++s   +++ + ++l+ gWk+ p+ s+SaW+
  Pbr022696.1 545 IRNIVVVEGSERVVRSVTMEVWRAFFARFRMVEINLSNAALYQASLVAKKFGSPPCTLDWKGKCLIVGWKGTPIHSLSAWK 625
                  ****************************************************999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.919235605IPR005202Transcription factor GRAS
PfamPF035142.5E-81262625IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 628 aa     Download sequence    Send to blast
MANSFFSFTP FDFGVLGGGG GLTPQLEDYD KEDQELKGKP DHLFGIEELG LGEMEKLSHL  60
SKDQQQSKAS YLMLDNFSFH TGCSEHDLQR PSFKSEKARA HVSKDHDHRH YQQQNQHYQQ  120
PSKSNYSDWD NFTFDSAFPS TQPIQDATNE LTYSQIGESD IAETNKQMPH QSSLAVLELL  180
NNYGSAFKNL RGDRLSNRCN EAEASLFSIQ QKLSTEEIMR VAGARYVQFS NQGYGDFFMP  240
LHPFGYALSG LSEEETKDVE LAHILLAAAE KVGYQQFERA NRLLLRCEFA ASFKVNPVQR  300
VVFYFAEALR KRIEKETGNG MYKGNEISTY SNGLSTNLTF LAFYQDTPFH SVMQHPGIQV  360
ILENVALESN VHLIDLEIRS GVQWTGLMEV LAGREECHIE LLTITAVGVT GKQKIEETGR  420
RLASVAKALN LPFQFKAVIV ADMEDVKDQL FDVEDYEAVV VYAPLILRTM ISRPSCLENL  480
MRVMRNLSPC VMVVIEVEAN HNSPSFVNRF IDALFYYSAL FDCLEACMKQ EKDRVLMEGL  540
LHEGIRNIVV VEGSERVVRS VTMEVWRAFF ARFRMVEINL SNAALYQASL VAKKFGSPPC  600
TLDWKGKCLI VGWKGTPIHS LSAWKFT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-2929062532375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009378753.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM5VUD50.0M5VUD5_PRUPE; Uncharacterized protein
STRINGVIT_07s0005g01500.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-48RGA-like 1